PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912317.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 241aa    MW: 27567.9 Da    PI: 8.4259
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912317.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.95.6e-4241341127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     lppG+rF Pt+eel+++yL++k+e+++ ++e+vi+ v++y+++P +Lp    +++  + ++w+fF++ ++++a+g r++r+t sgyWk tg+   
  XP_010912317.1   4 LPPGYRFYPTEEELLSFYLRNKLENRRQDMERVIPVVGVYSYDPVQLPpIsgEASIrDPEQWFFFCPMQEREAQGGRPTRTTPSGYWKLTGSPSY 98 
                     79****************************99***************95344332324569********************************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     vls+++  +g kkt+vfy+grap+g+kt+W m+ey+
  XP_010912317.1  99 VLSSQNLRIGWKKTMVFYTGRAPTGTKTKWKMNEYK 134
                     ***99999***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-472162IPR003441NAC domain
PROSITE profilePS5100545.8654162IPR003441NAC domain
PfamPF023652.4E-235134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MTDLPPGYRF YPTEEELLSF YLRNKLENRR QDMERVIPVV GVYSYDPVQL PPISGEASIR  60
DPEQWFFFCP MQEREAQGGR PTRTTPSGYW KLTGSPSYVL SSQNLRIGWK KTMVFYTGRA  120
PTGTKTKWKM NEYKALEEAV ATTSSTHPKL RNEFSVCRVY IKSGTLRSFD RRPSANVAMN  180
SESRRRNPEA SSSANPQIAE RTSSHGCSSP RDDGLLPLAA DGTFDWNMLE DIDPEQFGRW  240
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-32416517168NO APICAL MERISTEM PROTEIN
1ut4_B4e-32416517168NO APICAL MERISTEM PROTEIN
1ut7_A4e-32416517168NO APICAL MERISTEM PROTEIN
1ut7_B4e-32416517168NO APICAL MERISTEM PROTEIN
4dul_A4e-32416517168NAC domain-containing protein 19
4dul_B4e-32416517168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912317.10.0PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR34e-74NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0M4G3P65e-87A0A0M4G3P6_MANES; NAC transcription factors 36
STRINGGSMUA_Achr10P04720_0014e-86(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-75NAC domain containing protein 90